DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACSL3 and CG11453

DIOPT Version :9

Sequence 1:NP_001341087.1 Gene:ACSL3 / 2181 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_650832.1 Gene:CG11453 / 42355 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster


Alignment Length:466 Identity:108/466 - (23%)
Similarity:174/466 - (37%) Gaps:143/466 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   187 VTLYATLGGPAIVHAL----NETEVTNI--ITSKELL--QTKLKDIVSLVPRL--RHIITVD--- 238
            |.|...|.|... ||:    :|..:.::  ||..:|:  ..|....:|::.|:  .|:.|:.   
  Fly    96 VVLGCLLNGTPF-HAVSPWQDEDTIKHLFSITRPKLIFCDGKCFQRLSIIARILKSHVYTLKDHR 159

Human   239 -GKP-------PTWSEF---PKGIIV---HTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSG 289
             |.|       ||.:|.   |:.:::   ||:|                          |:.|||
  Fly   160 LGMPRVEDLLEPTTAELYYVPETLLLGGDHTVA--------------------------ILCTSG 198

Human   290 STGLPKGVMISHSNII---AGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGC---- 347
            :|||||.|.||:|..:   ..:||          :||.:.:    ..::.||.:..:...|    
  Fly   199 TTGLPKAVCISNSACLFDFGFVTG----------QDVLLSF----STIDWSAGMFNMLFSCCHGS 249

Human   348 -RIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFIL 411
             ||....|.|.......::|        .|.||:..||                           
  Fly   250 TRIITDRPYTPEYMIQLVEK--------YKVTLLTVVP--------------------------- 279

Human   412 AYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYG 476
                  :|::....||..:......:|.:..|       ||:...|...:.........:..||.
  Fly   280 ------QQVASLLKTPTLNKQRLASIRFVSVG-------GGSCYVANLLKLQEFLITGQISYGYA 331

Human   477 LTESAG-AGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPH-PRGEILIGGQSVTMGY 539
            |||..| |..:......:.||: .|    .:::|..:|.|   ....| ..||||:....|..||
  Fly   332 LTECGGVAANMGVAKPSSVGRI-VP----GVRVKILDEAG---RSLGHGETGEILVHNGKVWNGY 388

Human   540 Y--KNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALK 602
            |  .||:|...|:      |.|..|||:|.|:.:..|.|::||:||::....:| |..::|..:.
  Fly   389 YANPNESKRMQDY------QGWFHTGDMGYFDNENYLHIVERKEDLLRFHGAQY-SPQEIEQVIA 446

Human   603 NLPLVDNICAY 613
            .||.|...|.:
  Fly   447 ELPDVIEACVF 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AFD_class_I 30..717 CDD:418409 108/466 (23%)
CG11453NP_650832.1 CaiC 18..530 CDD:223395 108/466 (23%)
Firefly_Luc_like 46..519 CDD:213279 108/466 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.