DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACSL3 and CG6300

DIOPT Version :9

Sequence 1:NP_001341087.1 Gene:ACSL3 / 2181 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_650828.1 Gene:CG6300 / 42351 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster


Alignment Length:496 Identity:108/496 - (21%)
Similarity:184/496 - (37%) Gaps:156/496 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   196 PAIVHALNETEVTNIITSKELLQTKLK-------------DIVSLVPR-LRHIITVDGKPPTWSE 246
            |.:...::.||.| ::|..|||...::             |||.::.| ..|::.|     .::.
  Fly    43 PQLTAQISATEGT-VLTRGELLANAMRLASYMRSLGLLQSDIVGIIGRNTTHMLAV-----AYAC 101

Human   247 FPKGIIVHTM--------------------------------AAVEALGAK-ASMENQP------ 272
            |..||..|::                                :|...|..| .:|.|.|      
  Fly   102 FFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDEFEKVRSATAELDVKIVTMRNHPLDSIKI 166

Human   273 ---HSKPLPSDI------------AVIMYTSGSTGLPKGVMISHS-NIIAGITGMAERIPELGEE 321
               .:.|:..:.            ..|:.:||:||.||.|.|::| :|:||..       .|...
  Fly   167 DEVVATPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKAVTITNSRHILAGNY-------HLTTA 224

Human   322 DVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ------SSKIKKGSKGDTSMLKPTLM 380
            ||...:..|..:..|   |..::.|.   :|:.:.:||.      :.:|.:..|...::..|:.|
  Fly   225 DVQYSHNTLDWITGL---LTTITSGV---FSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSM 283

Human   381 AAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPL---CDSFVFRKVRSLLG 442
            |.:....|       .:..:|||.:  .::...:....::.||..:.|   |..||         
  Fly   284 ALMINCPD-------FETCDMSSLR--CYMFGGSRAALEVQKGIRSRLSHDCLQFV--------- 330

Human   443 GNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIK 507
                                            ||.||.....||:..:|..||.||..:...::|
  Fly   331 --------------------------------YGFTELGAMATINCHFDEKTGSVGQLVNGLKMK 363

Human   508 LKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDG 572
            :.| ::|.....|:   .||:.|.......|||.||.:|:.  ..|..|  |..:||:|..:.||
  Fly   364 IIN-DDGESLGPDE---IGEVCIMNNQHWSGYYGNEVETRN--MRDSLG--WYHSGDLGYMDRDG 420

Human   573 CLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAY 613
            .|.|:||||:::|.|...|.. ..:|:.:..:|.|..:|.:
  Fly   421 FLYIMDRKKEMLKYQNIMYYP-NDIESVISEMPQVAEVCVF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AFD_class_I 30..717 CDD:418409 108/496 (22%)
CG6300NP_650828.1 CaiC 26..523 CDD:223395 108/496 (22%)
AFD_class_I 47..522 CDD:302604 107/492 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.