DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgfb3 and scw

DIOPT Version :9

Sequence 1:NP_033394.2 Gene:Tgfb3 / 21809 MGIID:98727 Length:412 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:447 Identity:103/447 - (23%)
Similarity:171/447 - (38%) Gaps:120/447 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 SLSTCTTLDFGHIK----KKRVEAIRGQILSKLRLTSPP----EPSVMTHVPYQVLALYNSTREL 79
            |.:|..|.: .||:    :||..:.:.:::..|.|...|    ||:           |:||..:.
  Fly    15 SATTYVTTN-NHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPN-----------LHNSASKF 67

Mouse    80 LEEMHGEREEGCTQETSESEYYAKEIHK----FDMIQGLAEHNELAVC-----------PKGITS 129
            |.|::.|     ..|..|.:....:.||    .|::....:..|:|.|           |:.:.:
  Fly    68 LLEVYNE-----ISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDN 127

Mouse   130 KV---FRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQIL--RPDEHIAKQRYIGGK 189
            ::   ..||.:.|..: .:|.:|..|:.:.|:...:|....:.:::.|  |.|   ...|.:|..
  Fly   128 ELDMHITFNTNDVPVD-LSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQD---FSYRILGSV 188

Mouse   190 NLPTRGTAEWLSFDVTDTVREWL----LRRESNLGLEISIHCPCHTF--------------QP-- 234
            | .|.....||.|::|||:|.||    |:|.:.|.:.|. .....||              :|  
  Fly   189 N-TTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIG-DSQLSTFAAGLVTPQASRTSLEPFI 251

Mouse   235 ----NGDILENVHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD--SPGQ 293
                ||.  |.:.::.:::||          .||.:.:.......|.      ||..:|  .|.|
  Fly   252 VGYFNGP--ELLVKIQKLRFK----------RDLEKRRAGGGSPPPP------PPPPVDLYRPPQ 298

Mouse   294 GSQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY---LRSAD 355
            ..:|      .|:.              :||::.....||..||.:.|.||.|.|.:   .:...
  Fly   299 SCER------LNFT--------------VDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNA 343

Mouse   356 TTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGR-TPKVEQLSNMVVKSCKC 411
            |.|:.|..|.:...|.. ..|||||..|..:|||.|:.. ...:.:....|.|.|.|
  Fly   344 TNHAIVQTLMHLKQPHL-PKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tgfb3NP_033394.2 TGFb_propeptide 24..230 CDD:366248 54/237 (23%)
TGF_beta_TGFB3 312..412 CDD:381656 30/104 (29%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/236 (22%)
TGFB 300..400 CDD:214556 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.