DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgfb2 and scw

DIOPT Version :9

Sequence 1:NP_001316036.1 Gene:Tgfb2 / 21808 MGIID:98726 Length:442 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:469 Identity:102/469 - (21%)
Similarity:185/469 - (39%) Gaps:102/469 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 VLSTFLLLHLVPVALS---LSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPDEVPPE 66
            :|:.|.|..|...|.:   ::|.:.::|..: :||..:.:.:::..|.|...|....||      
  Fly     1 MLNVFFLTSLFYAASATTYVTTNNHIEMPIY-QKRPLSEQMEMIDILDLGDRPRRQAEP------ 58

Mouse    67 VISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHLPSETVCPVVTTPSGSLGSF 131
              :::||....|.|..:.   ..|.:...|..:.:....:|....:.:|....:.:  ..|:.:|
  Fly    59 --NLHNSASKFLLEVYNE---ISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIAS--CNSILTF 116

Mouse   132 CSR-QSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQRIE 195
            .|| :.:.|...||           ..:.|:.:.:..:.| ||:|..|:::..:...|.|...:.
  Fly   117 SSRLKPEQLDNELD-----------MHITFNTNDVPVDLS-LVQAMLRIYKQPSLVDRRANFTVS 169

Mouse   196 LYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLHHK--DRNLGFKISLHCPCCT 258
            :|:.|.::...|  .|.:.| |..|.::..||.|::||.::.|||:|  .|....:||:      
  Fly   170 VYRKLDNRQDFS--YRILGS-VNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISI------ 225

Mouse   259 FVPSNNYIIPNKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKT--------PHLLLMLLP 315
                                 |....||:|:|   .:.....:||.:.        |.||:    
  Fly   226 ---------------------GDSQLSTFAAG---LVTPQASRTSLEPFIVGYFNGPELLV---- 262

Mouse   316 SYRLESQQSSR--RKKRA------------LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEP 366
              :::..:..|  .|:||            :|   .:|..| :|......:|||......|:..|
  Fly   263 --KIQKLRFKRDLEKRRAGGGSPPPPPPPPVD---LYRPPQ-SCERLNFTVDFKELHMHNWVIAP 321

Mouse   367 KGYNANFCAGACPYLWSSD---TQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIG-NTPK 427
            |.:.|.||.|.|.:...:.   |.|..|.:|.:...|.. ..||||...|..:|||.|:. :...
  Fly   322 KKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHL-PKPCCVPTVLGAITILRYLNEDIID 385

Mouse   428 IEQLSNMIVKSCKC 441
            :.:....:.|.|.|
  Fly   386 LTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tgfb2NP_001316036.1 TGFb_propeptide 21..256 CDD:279078 51/237 (22%)
TGF_beta 344..441 CDD:278448 28/100 (28%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 54/272 (20%)
TGFB 300..400 CDD:214556 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.