DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALDH3A1 and CG12516

DIOPT Version :10

Sequence 1:XP_047291551.1 Gene:ALDH3A1 / 218 HGNCID:405 Length:570 Species:Homo sapiens
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:113 Identity:27/113 - (23%)
Similarity:42/113 - (37%) Gaps:30/113 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   114 EDPGANVS--------NIQLQQKISSLEIKLK-----VSEEEKQRIKQDVESLMEKH----NVLE 161
            :|.|:.|:        |:.:|| .|..||.:|     :..|.|...|||....:.:|    .||.
  Fly    77 KDSGSTVNVTGDKFQINLDVQQ-FSPEEISVKYVDKSIVVEGKHEEKQDEHGYISRHFVRRYVLP 140

Human   162 KGFLKEKEQEAISFQDR---------YKELQEKHKQELEDMRKAGHEA 200
            .|   ..|.:.:|....         .|||::|..:....:...|..|
  Fly   141 NG---HNESDIVSSLSSDGILTITCPRKELEQKKPERAIPITHTGQPA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALDH3A1XP_047291551.1 ALDH-SF <248..564 CDD:448367
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 25/108 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.