DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FANCD2 and fancd2

DIOPT Version :10

Sequence 1:NP_149075.2 Gene:FANCD2 / 2177 HGNCID:3585 Length:1471 Species:Homo sapiens
Sequence 2:XP_002934277.3 Gene:fancd2 / 100487938 XenbaseID:XB-GENE-984801 Length:1449 Species:Xenopus tropicalis


Alignment Length:77 Identity:19/77 - (24%)
Similarity:33/77 - (42%) Gaps:18/77 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   232 GSVDGFIEVWNFTTGKIRKDLKYQAQDNFMMMDDAVLCMCFSRDTEMLATGAQ-DGKIKVWKIQS 295
            |.:.|...|::..||:.|.    .|...|..:||       |::....|.|.: ||:    :|:.
 Frog    42 GPLSGVNVVYDQRTGRSRG----FAFVYFERIDD-------SKEAMERANGMELDGR----RIRV 91

Human   296 GQCLRRFERAHS 307
            ...:.:  |||:
 Frog    92 DYSITK--RAHT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FANCD2NP_149075.2 Interaction with FANCE 1..291 15/59 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
FancD2 35..1415 CDD:464225 19/77 (25%)
Interaction with BRCA2 248..359 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 868..906
fancd2XP_002934277.3 FancD2 43..1405 CDD:464225 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.