DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tek and drpr

DIOPT Version :9

Sequence 1:NP_038718.2 Gene:Tek / 21687 MGIID:98664 Length:1123 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:315 Identity:84/315 - (26%)
Similarity:115/315 - (36%) Gaps:88/315 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   209 RRCEAQKWGPD--------------------------------CSRPCT------------TCKN 229
            |.|||.|:|.|                                |:||||            .|||
  Fly   346 RICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKN 410

Mouse   230 NGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWR 294
            ...|....|.|:|.||:.|.|||::|||.|||:.|..||....|.|    |.|:...|.|..||:
  Fly   411 GAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAK----CEPETGQCLCTAGWK 471

Mouse   295 GLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQG-CLCSQGWQGLQCEKEGRPRMTPQIEDLPDH 358
            .::|:..|...::|.||...|.|.|...|:...| |.|:.||.|.:||:                
  Fly   472 NIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCER---------------- 520

Mouse   359 IEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFN------------YTDRF-SVAIFT 410
             :.::|||...| |.......:..:.....:|..:...|:.            |.:.. .|....
  Fly   521 -KCDTGKFGHDC-AQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCL 583

Mouse   411 VNRVLPPDSGVWVCSVNTVAGMVEKP-----FNISVKV-LPEPLHAPNVID--TG 457
            .|....||||..:||.........:|     :.:..|. .||.||.....|  ||
  Fly   584 NNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITG 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TekNP_038718.2 Ig_Tie2_1 24..118 CDD:287411
EGF_Lam 230..275 CDD:238012 20/44 (45%)
EGF_2 311..340 CDD:285248 11/29 (38%)
fn3 445..516 CDD:278470 7/15 (47%)
fn3 542..625 CDD:278470
FN3 638..730 CDD:238020
PTKc_Tie2 815..1117 CDD:133219
STYKc 823..1091 CDD:214568
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 14/38 (37%)
DSL <567..606 CDD:302925 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.