DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs7b and CG31937

DIOPT Version :9

Sequence 1:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:252 Identity:85/252 - (33%)
Similarity:133/252 - (52%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 SKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQG--QTHQPF 108
            |.:.:|..||.:|||:||:||..|......|.||||..|.::.||::..|...:::|  .|....
  Fly    40 SLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVL 104

Mouse   109 VVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTK 173
            |:..|:.|..........:|..|..:|||:||||.|.|.:.::..::|||::.|::.|..|.|::
  Fly   105 VIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSR 169

Mouse   174 ALLPSMVERK--QGHIVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPG 236
            .::...||:.  :|||.|.|||.|...:||...|.|:|||..|:...|:.||.:  :.|::.:||
  Fly   170 LVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRK--LDVSLFAPG 232

Mouse   237 YIHTNLSVNAVTADGSRYGALDKNTA-QGRSAAEVAQDVFDAVGKKKKDVLLTDFVP 292
            .|.|:....|.|  ||:.|.:..:|| |.|..|:...|:|......|.|:......|
  Fly   233 PIATDFLQEAFT--GSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 84/248 (34%)
PRK06181 52..319 CDD:235726 83/246 (34%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 84/248 (34%)
adh_short 47..245 CDD:278532 70/201 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.