Sequence 1: | NP_035698.1 | Gene: | Alyref / 21681 | MGIID: | 1341044 | Length: | 255 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573324.1 | Gene: | CG18259 / 32866 | FlyBaseID: | FBgn0030956 | Length: | 474 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 56/200 - (28%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 49/200 - (24%) |
- Green bases have known domain annotations that are detailed below.
Mouse 4 KMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGAVQAAARVNRGGGPMRNRPAIARGAAGG 68
Mouse 69 GRNRPAPYS-RPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK 132
Mouse 133 KAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDTQRRPAQSINRG 197
Mouse 198 GMTRN 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Alyref | NP_035698.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..83 | 21/79 (27%) | |
Sufficient for RNA-binding, interaction with NXF1-NXT1 heterodimer. /evidence=ECO:0000250 | 16..37 | 7/20 (35%) | |||
RRM_THOC4 | 106..179 | CDD:241124 | 27/72 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 185..255 | 3/17 (18%) | |||
CG18259 | NP_573324.1 | RRM | <345..>443 | CDD:223796 | 38/135 (28%) |
RRM_SKAR | 366..434 | CDD:241125 | 27/73 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0533 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |