DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx2 and Jafrac2

DIOPT Version :9

Sequence 1:NP_001304314.1 Gene:Prdx2 / 21672 MGIID:109486 Length:198 Species:Mus musculus
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:193 Identity:132/193 - (68%)
Similarity:154/193 - (79%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 AQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC 70
            |.|.|.||.|..||||:....::.||.|.||||||.|||||||||||||||||||...:|:|:..
  Fly    50 AVISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKT 114

Mouse    71 EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAK 135
            ||:||||||.|||||||||||||||||.:.||||:|:|..:|::|||.....|.|.|||||||..
  Fly   115 EVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQT 179

Mouse   136 GVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198
            |||||||:|||||||||||.:||||||||||.|||||||||:||:|||.||.::..:||:|:|
  Fly   180 GVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAKNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx2NP_001304314.1 PTZ00253 1..195 CDD:140280 129/188 (69%)
PRX_Typ2cys 8..179 CDD:239313 120/170 (71%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 120/170 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.