DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx2 and Prx6005

DIOPT Version :9

Sequence 1:NP_001304314.1 Gene:Prdx2 / 21672 MGIID:109486 Length:198 Species:Mus musculus
Sequence 2:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:63/207 - (30%)
Similarity:98/207 - (47%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 SGNA-QIGKSAPDFTATAVVDGAFKEIKLSDY---RGKYVVLFFYPLDFTFVCPTEIIAFSDHAE 63
            ||.| .||...|:|||..      .|.::..|   :..:.:||.:|.|||.||.||:...:....
  Fly     2 SGKALNIGDQFPNFTAET------SEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIP 60

Mouse    64 DFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKND----EGI 124
            :|:|.|.:.:.:|.|:..:|..||...:..|.|...:.|::||..:.|:..:.:|..|    |||
  Fly    61 EFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGI 125

Mouse   125 --AYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS-----DT 182
              ..|.:|::|.|..||...:.....||:.||.||::.:.|.|.......||.||.|.     .|
  Fly   126 PLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPT 190

Mouse   183 IKPNVDDSKEYF 194
            :|  .:|..:.|
  Fly   191 VK--AEDVPKLF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx2NP_001304314.1 PTZ00253 1..195 CDD:140280 63/207 (30%)
PRX_Typ2cys 8..179 CDD:239313 55/179 (31%)
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 60/201 (30%)
AhpC 8..198 CDD:223527 59/197 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.