DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FABP4 and fabp

DIOPT Version :10

Sequence 1:NP_001433.1 Gene:FABP4 / 2167 HGNCID:3559 Length:132 Species:Homo sapiens
Sequence 2:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster


Alignment Length:113 Identity:59/113 - (52%)
Similarity:75/113 - (66%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     4 AFVG-TWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFIL 67
            :||| .:||..|||||:||||:|||..|||:.....|.:.:::.||..|:.:.||||.:.|||.|
  Fly     2 SFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66

Human    68 GQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLV 115
            |.||||.|.|.|.|||.|||||..|...||.| |.|||.|:..|::|:
  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FABP4NP_001433.1 FABP4 2..131 CDD:381242 59/113 (52%)
Nuclear localization signal. /evidence=ECO:0000250 22..32 6/9 (67%)
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 59/113 (52%)

Return to query results.
Submit another query.