DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FAAH and CG5191

DIOPT Version :9

Sequence 1:NP_001432.2 Gene:FAAH / 2166 HGNCID:3553 Length:579 Species:Homo sapiens
Sequence 2:NP_650893.2 Gene:CG5191 / 42431 FlyBaseID:FBgn0038803 Length:552 Species:Drosophila melanogaster


Alignment Length:574 Identity:142/574 - (24%)
Similarity:216/574 - (37%) Gaps:164/574 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    63 RLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQ 127
            |.:.|.:.|. ||.:|...|.:.:.:|::..|.|:..|:.:..:||...|.:..  ...|..|.:
  Fly    53 RRKLPPIRSH-LLEIPAVDLAKLIRTRKIKSEEVVEAYIERCRQVNPLINAIVQ--DRFEEALEE 114

Human   128 APR------QGL-----------LYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLK 175
            |..      .|:           |.|:||::||....||..:..|........|:.|:.||..:|
  Fly   115 AREIDNVIAMGINSVESMEELTPLLGIPVTVKESIAVKGMTNQAGRVFKTPQIAKSDAPVVEQIK 179

Human   176 LQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG 240
            ..|.:..:.:|.|:....::..|.:.|||.||:...::||||||||.||:.||.|.|||.:||||
  Fly   180 RSGGIILLVSNTPELCLLWETYNNVTGQTKNPYDLKRTPGGSSGGEAALLASGASLLGLTSDIGG 244

Human   241 SIRFPSSFCGICGLKPTGNRLSKSGLKG----CVYGQEAVRLSVGPMARDVESLALCLRALLCED 301
            |.|.|:.|.||.|.|||...:|   .||    ..:.:.....::.||.|..:.|.|.|:.:    
  Fly   245 SSRLPAMFSGIWGHKPTPYAVS---FKGHHPTSDFPKWGDFFTIAPMTRYAKDLPLLLKCM---- 302

Human   302 MFRLDPTVPPLPFREEVYTSSQPLRVG---YYETDNYTMPSPAMR-------------------- 343
               .|||.|.|       |..:|:.|.   ::..|| ..||..||                    
  Fly   303 ---SDPTGPKL-------TLDRPISVNGIRFFFMDN-DGPSGMMRPLSRDLHAAINRVATDFNAK 356

Human   344 --------------RAVLETKQSLEAAGH-TLVPFLPSNIPHALETLSTGGLFSDG-------GH 386
                          .:.:.|.:::|...| |.....|..:  ..||:......||.       ||
  Fly   357 RVNIRKMKWSLDISLSAMLTMKNIETIYHKTEEGEQPKTV--CKETVKYFFGCSDSILPSVIFGH 419

Human   387 TFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEI 451
              ||||.....:.....|.||::       .|....|.:|.....||......:|.:.:::.|::
  Fly   420 --LQNFMKIIPNSRHKHLASIIE-------ALKTEFKEMLGNDGVFLYPTFPNTAHQHYQIYHKL 475

Human   452 EVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAED 516
                               |.||                  |..::|.|.     :|||....  
  Fly   476 -------------------LEPM------------------YMAIFNTLG-----LPVTNCMI-- 496

Human   517 EAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVER 570
                                 |:.:. .||:.:|.||.|.|:.|.|...||:||
  Fly   497 ---------------------GLDRR-NLPMGIQVVANPGQDHLSLAVAREMER 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FAAHNP_001432.2 Amidase 95..562 CDD:279733 128/532 (24%)
Substrate binding. /evidence=ECO:0000250 238..241 2/2 (100%)
CG5191NP_650893.2 GatA 61..537 CDD:223232 140/566 (25%)
PRK07488 63..537 CDD:236030 139/563 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.69812 Normalized mean entropy S4795
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D852596at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1914
SonicParanoid 1 1.000 - - X256
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.