DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dynlt1b and Dlc90F

DIOPT Version :9

Sequence 1:NP_033368.1 Gene:Dynlt1b / 21648 MGIID:98643 Length:113 Species:Mus musculus
Sequence 2:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster


Alignment Length:113 Identity:76/113 - (67%)
Similarity:94/113 - (83%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MEDFQASEETAFVVDEVSSIVKEAIESAIGGNAYQHSKVNQWTTNVLEQTLSQLTKLGRPFKYIV 65
            |:|  :.||:.|:||:||..:|||||:.||||||||.|||.||..|:|..|:.|||..:|:||||
  Fly     1 MDD--SREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIV 63

Mouse    66 TCVIMQKNGAGLHSASSCFWDSSTDGSCTVRWENKTMYCIVSTFGLSI 113
            |.:||||||||||:||||:|::.|||||||||||||||||||.|||::
  Fly    64 TAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dynlt1bNP_033368.1 Tctex-1 16..111 CDD:367593 67/94 (71%)
Interaction with GNB1. /evidence=ECO:0000250 41..113 51/71 (72%)
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 72/100 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833033
Domainoid 1 1.000 153 1.000 Domainoid score I4293
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4754
Inparanoid 1 1.050 166 1.000 Inparanoid score I4173
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 1 1.000 - - oto92767
orthoMCL 1 0.900 - - OOG6_101714
Panther 1 1.100 - - LDO PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4548
SonicParanoid 1 1.000 - - X5146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.