DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh16f2 and Adhr

DIOPT Version :9

Sequence 1:NP_663399.2 Gene:Rdh16f2 / 216454 MGIID:3583955 Length:318 Species:Mus musculus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:237 Identity:51/237 - (21%)
Similarity:94/237 - (39%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 LQDKYV-FITGCGSGFGNLLARQLDRRGMRVLAACRKEEGAEELRRKTSERLETVIL----DVTK 86
            |..|:| ::..|| |.....::.|..:.:..||..:..|..:.:.:..|.:..|.|.    |||.
  Fly     4 LTGKHVCYVADCG-GIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTM 67

Mouse    87 T--------ENIVAATQWVKERVGNRGLWGLVNNAGISVPSGPNEWMKKQDFASVLDVNLLGLIE 143
            .        :.::....::..         |:|.|.:         ..:.:..:.::.||.|::.
  Fly    68 AREDMKKYFDEVMVQMDYIDV---------LINGATL---------CDENNIDATINTNLTGMMN 114

Mouse   144 VTLSMLPLV-RK---ARGRVVNVSSILGRVSLGGSGGYC---ISKYGIEAFSDSLRRELRYFGVK 201
            ...::||.: ||   ..|.:|||:|::|   |..|..:|   .||:|:..|:.||...|.|    
  Fly   115 TVATVLPYMDRKMGGTGGLIVNVTSVIG---LDPSPVFCAYSASKFGVIGFTRSLADPLYY---- 172

Mouse   202 VAIIEPGFFLTGMASSARLCSNIQMLWDQTSSEIREIYGEKY 243
                    ...|:|..|..|...::..|:......| ||:.:
  Fly   173 --------SQNGVAVMAVCCGPTRVFVDRELKAFLE-YGQSF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh16f2NP_663399.2 type2_17beta_HSD-like_SDR_c 30..307 CDD:187665 50/234 (21%)
adh_short 30..219 CDD:278532 44/208 (21%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 50/234 (21%)
adh_short 7..195 CDD:278532 47/221 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.