DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh19 and Adhr

DIOPT Version :9

Sequence 1:NP_671755.2 Gene:Rdh19 / 216453 MGIID:2678390 Length:318 Species:Mus musculus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:193 Identity:48/193 - (24%)
Similarity:79/193 - (40%) Gaps:55/193 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 LVNNAGISVPLGLSQWMNKQNFASVLDVNLLGMIEVTLTMLPLV-RK---ARGRVVNVSSIMGRV 169
            |:|.|.:         .::.|..:.::.||.||:....|:||.: ||   ..|.:|||:|::|..
  Fly    89 LINGATL---------CDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLD 144

Mouse   170 SLHGNGGYCISKYGVEAFSDSLRRELSYF--GVKVAIIEPG------------FFLTGMASSARL 220
            .......|..||:||..|:.||...|.|.  ||.|..:..|            |...|.:.:.||
  Fly   145 PSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEYGQSFADRL 209

Mouse   221 ---------------------SSNTQMLW--DQTSSEIREIYGEKYLA----FYLKSLNELDK 256
                                 |.|.| :|  |:...|:.:::...::|    .|::|.:|.|:
  Fly   210 RRAPCQSTSVCGQNIVNAIERSENGQ-IWIADKGGLELVKLHWYWHMADQFVHYMQSNDEEDQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh19NP_671755.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 48/193 (25%)
adh_short 30..219 CDD:278532 35/127 (28%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 43/168 (26%)
adh_short 7..195 CDD:278532 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.