DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mars1 and AIMP3

DIOPT Version :9

Sequence 1:NP_001165053.1 Gene:Mars1 / 216443 MGIID:1345633 Length:910 Species:Mus musculus
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:98 Identity:20/98 - (20%)
Similarity:45/98 - (45%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    83 QWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIV 147
            ||:|:....:.|            |.|.:.:   .:::|...:...:.::  :|.|...:|||:.
  Fly    73 QWIEFSVLYVAP------------GSKDKYV---SKQLLADFNKLFASKS--YLVGHFITLADLA 120

Mouse   148 LWGALYPLLQDPAYLPEELGA-LQSWFQTLSTQ 179
            ::.|:|.|::..:.:.:|:.. |..||..|..:
  Fly   121 VYYAIYDLVKSLSPVDKEVYLNLSRWFDHLQNR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mars1NP_001165053.1 Thioredoxin_like 1..68 CDD:294274
GstA <47..189 CDD:223698 20/98 (20%)
GST_C_MetRS_N 77..179 CDD:198340 20/96 (21%)
PRK12268 266..821 CDD:237029
MetRS_core 267..635 CDD:173907
'HIGH' region 275..285
'KMSKS' region 595..599
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.