DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG11836

DIOPT Version :9

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:243 Identity:92/243 - (37%)
Similarity:143/243 - (58%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   230 NNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRV--GDRN 292
            |...|||||:.....:.||.|.:: .:.:..|||::|::.|:|:||||:.:.::.|:||  ||.:
  Fly    92 NEEIRIVGGKPTGVNQYPWMARIV-YDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHD 155

Human   293 TEQEEGGEAVHE-VEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQ 356
            .|.....:|:.. |..||||..|..:||:.|||:|||:.||:|...:.|.|||..::..:    .
  Fly   156 QEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPA----G 216

Human   357 KTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLS--SSFIITQNMFCAGYDTKQEDACQGDS 419
            :.|.|.|:|||.|.|...:.:..::||.:....|:..  .|..||.:|.|||..:.  |:|||||
  Fly   217 RIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSM--DSCQGDS 279

Human   420 GGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMK 467
            |||.:......||:.||||||.||.|:|..|:|::|:.|:.||..:::
  Fly   280 GGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 90/233 (39%)
O-glycosylated at one site 476..485
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 90/234 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H30976
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4142
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.