DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG9631

DIOPT Version :10

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:75 Identity:19/75 - (25%)
Similarity:34/75 - (45%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     6 TIKIDPVTGMVMNLTDLKEYMEEAIMKPLDHKNLDLDVPYFADA---VSTTENVAVYIWESLQKL 67
            |:.::.:.|       ||.|     :.|.|...|.::.|....|   |:||...|:. :::|:| 
  Fly    76 TVPLEAMFG-------LKTY-----VAPDDTPMLMVEPPANTHAPVIVTTTMEPAIQ-FQTLRK- 126

Human    68 LPVGALYKVK 77
             |.|...|::
  Fly   127 -PNGLCGKLE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503 15/56 (27%)
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113
O-glycosylated at one site 476..485
CG9631NP_650345.1 GD_N 26..132 CDD:464985 18/70 (26%)
Tryp_SPc 198..436 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.