DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG9372

DIOPT Version :10

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:53 Identity:13/53 - (24%)
Similarity:25/53 - (47%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    42 DVPYFADAVSTTENVAVYI-----WESLQKLLPVG---ALYKVKVFETDNNIV 86
            |:.:..|.:||.::.||.:     |:.  |..|..   :.|:::|.:....||
  Fly   129 DLQFVIDDISTEDSSAVGVSWHLEWKG--KNFPFSKGCSFYRLEVIDGKRQIV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503 11/50 (22%)
EGF_CA 86..122 CDD:238011 1/1 (100%)
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113
O-glycosylated at one site 476..485
CG9372NP_649132.1 CLIP 87..132 CDD:197829 1/2 (50%)
Tryp_SPc 173..402 CDD:214473 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.