DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG10663

DIOPT Version :10

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:44 Identity:15/44 - (34%)
Similarity:24/44 - (54%) Gaps:7/44 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    24 EYMEEAIMKPLDHKNLDLDVPYFADAVSTTENVAVYIWESLQKL 67
            ::|||| |:...|...|. ..:.|:||:|     |.:.||::.|
  Fly   289 KHMEEA-MESYKHMVEDC-CKHMAEAVNT-----VLVLESIEHL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503 15/43 (35%)
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113
O-glycosylated at one site 476..485
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.