DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and kappaTry

DIOPT Version :10

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:81 Identity:15/81 - (18%)
Similarity:28/81 - (34%) Gaps:37/81 - (45%)


- Green bases have known domain annotations that are detailed below.


Human    43 VPYFADAVST-------TENVA-------VYIWESLQKLLP-----------------------V 70
            :|..::..:|       ||:|:       .|:..:|::|.|                       |
  Fly    10 IPETSNTTTTNGHGEERTESVSEQVPELPAYLHAALKQLAPKEGFTEGNFTIEFDFGSSKGDGFV 74

Human    71 GALYKVKVFETDNNIV 86
            |.::|..:.|.|...|
  Fly    75 GQMFKATISEGDRREV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503 14/78 (18%)
EGF_CA 86..122 CDD:238011 1/1 (100%)
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113
O-glycosylated at one site 476..485
kappaTryNP_610674.5 Tryp_SPc 26..256 CDD:238113 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.