DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F10 and CG17571

DIOPT Version :10

Sequence 1:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens
Sequence 2:NP_610109.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:30 Identity:8/30 - (26%)
Similarity:12/30 - (40%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     9 IDPVTGMVMNLTDLKEYMEEAIMKPLDHKN 38
            |||...:..|.  :..|...:.|..|:..|
  Fly   105 IDPANKLSANY--MATYQTSSKMLGLEWSN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F10NP_000495.1 GLA 25..85 CDD:214503 4/14 (29%)
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113
O-glycosylated at one site 476..485
CG17571NP_610109.1 Tryp_SPc 30..251 CDD:214473 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.