DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F9 and CG16749

DIOPT Version :10

Sequence 1:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:124/246 - (50%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAF-CGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEH 289
            |||.|.|:...::|:.:.:.|...:. |||||:::::::|||||.: |.|.:.::.::.:.:...
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTD-GRKASDLSVQYGVTKINA 92

Human   290 TEQKRNVIR---IIPHHNYNAAINKYNHDIALLELDEPLVLNSY-VTPICIADKEYTNIFLKF-- 348
            |..  ||:|   ||.|.:|| ..|.|.:||:||.::||...:.. |.|:.:.:       |.|  
  Fly    93 TGP--NVVRVKKIIQHEDYN-PYNNYANDISLLLVEEPFEFDGVTVAPVKLPE-------LAFAT 147

Human   349 ------GSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCL-RSTKFTIYNNMFCAGFHEGGRDS 406
                  |.|.:.|||.....|.....||.:.:.:.....|. |....|......|.|..|||:..
  Fly   148 PQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQ 212

Human   407 CQGDSGGPHVTEVEGTSFLTGIISWG-EECAMKGKYGIYTKVSRYVNWIKE 456
            |.||||||.:...:    ..||:||. :.|.:....|:|.|||:||:|||:
  Fly   213 CSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 227..457 CDD:238113 77/245 (31%)
CG16749NP_649881.1 Tryp_SPc 30..259 CDD:238113 76/243 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.