DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F9 and CG9372

DIOPT Version :10

Sequence 1:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:163 Identity:38/163 - (23%)
Similarity:58/163 - (35%) Gaps:49/163 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   112 PTSVAEWLDSIELGDYTKAFLINGYTSM-DLLKKIWELELINVLKISLIGHRKRILASLGDRLH- 174
            |||.:|.:.|     :..|..::..:|: ||:.:....|.: |.....:| ||.||...|..:. 
  Fly    68 PTSASEVVSS-----FYAAVNVHDLSSVTDLIAQDCVYEDL-VFSSPFVG-RKAILDFFGKFIES 125

Human   175 ---------DDPPQKPPRSITLRQSSVCEI-----WTNQNAGFPFS------------AIHQVHN 213
                     ||        |:...||...:     |..:|  ||||            ...|:..
  Fly   126 TSTDLQFVIDD--------ISTEDSSAVGVSWHLEWKGKN--FPFSKGCSFYRLEVIDGKRQIVY 180

Human   214 TGDWGEPSITLRPPNEATASTPVQYW--QHHPE 244
            ..|..||:|  :|.....|:.....|  |..|:
  Fly   181 GRDCVEPAI--KPGETVLAAIKGVTWLLQKFPQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 5/16 (31%)
FXa_inhibition 134..170 CDD:464251 10/36 (28%)
Tryp_SPc 227..457 CDD:238113 4/20 (20%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 11/46 (24%)
Tryp_SPc 173..402 CDD:214473 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.