DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F9 and CG4793

DIOPT Version :9

Sequence 1:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:435 Identity:106/435 - (24%)
Similarity:166/435 - (38%) Gaps:154/435 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    55 FVQGNLERECME-EKCSFEEAREVFENTERTTEFWKQYVD--GDQCESNPCLNGGSCKDDINSYE 116
            |..|::.:||:: .:|..            .||..:..:|  |        ||.|:         
  Fly    20 FCGGSMAKECVQRNRCRI------------GTETGRPIIDFRG--------LNNGN--------- 55

Human   117 CWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRL---AENQKSCEPAVPFPC 178
                     :.||...||                    |..||..:.   |:||     .:|..|
  Fly    56 ---------QGCESGQTC--------------------CPKTEILQYPVQADNQ-----PLPTEC 86

Human   179 G---RVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW 240
            |   |:.|..|  :|.|..:                                     |:.|:.||
  Fly    87 GHVNRIGVGFT--ITNARDI-------------------------------------AQKGELPW 112

Human   241 QVVLNGKVDA-----FCGGSIVNEKWIVTAA-HCVETGVKITVV-AGEHNIEE-TEHTEQKRNVI 297
            .|.|   :|:     ..|||::....::|:: ..:|...|..:| |||.:.|. ||....:...|
  Fly   113 MVAL---LDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAI 174

Human   298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHK 362
            |.|..|. |.::....::.|||.|..||.|:.::..||:.......|..:.   .|||||:    
  Fly   175 RKIVRHT-NLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRC---IVSGWGK---- 231

Human   363 GRSAL------VLQYLRVPLVDRATCLRSTK--------FTIYNNMFCAGFHEGGRDSCQGDSGG 413
             ::||      :|:.:.:|||||:.|  .||        |.:.|::.||| .|.|:|:|:||.|.
  Fly   232 -KTALDNSYMNILKKIELPLVDRSVC--QTKLQGPYGKDFILDNSLICAG-GEPGKDTCKGDGGA 292

Human   414 PHVTEVEGTS---FLTGIISWGEECAMKGKY-GIYTKVSRYVNWI 454
            |....::...   .|.||:::|..|.  |.. ..||.||:..:||
  Fly   293 PLACPLQSDPNRYELLGIVNFGFGCG--GPLPAAYTDVSQIRSWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F9NP_000124.1 GLA 28..92 CDD:214503 7/37 (19%)
EGF_CA 93..129 CDD:238011 5/37 (14%)
FXa_inhibition 134..170 CDD:317114 7/38 (18%)
Tryp_SPc 227..457 CDD:238113 76/254 (30%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/248 (31%)
Tryp_SPc 105..335 CDD:214473 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.