DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F2RL1 and TkR86C

DIOPT Version :9

Sequence 1:NP_005233.4 Gene:F2RL1 / 2150 HGNCID:3538 Length:397 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:428 Identity:93/428 - (21%)
Similarity:185/428 - (43%) Gaps:51/428 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     9 LLGAAILLAASLSCSGTIQGTSRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKL 73
            |:...||.......:..:..|...|..|:.:  |...|.:......:|::....:|....|....
  Fly    10 LVNCTILAVRRFELNSIVNTTLLGSLNRTEV--VSLLSSIIDNRDNLESINEAKDFLTECLFPSP 72

Human    74 TTVF-LP--------IVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFP 129
            |..: ||        |::.::..|.:..||:.||:.......:.....::.||::||||   ...
  Fly    73 TRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLL---MSS 134

Human   130 LKIAYH---IHGNNWIYGEALCNVLIGFFYGN--MYCSILFMTCLSVQRYWVIVNPMGH--SRKK 187
            |...::   :..::|.:|...|.  |..|..|  :..|:..:..:|..||..||:|:..  ||:|
  Fly   135 LNCVFNFIFMLNSDWPFGSIYCT--INNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRK 197

Human   188 ANIAIGISLAIWLLILLVTIPLYVVKQTI---FIPALNITTCHDVLPEQLLVGDMFNYFLSLAIG 249
            ..|   |.:.||.|..:::.|..:....:   :....:.|.|..:.|:......|.:|..:|.|.
  Fly   198 VRI---ILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIIL 259

Human   250 VFLF--PAFLTASAYVLMIRML-RSSAMDENSE------KKRKRAIKLIVTVLAMYLICFTPSNL 305
            |..:  |..:....|.||.|:| .|.::.||::      |.:::.:::.:.:::::.||:.|.:|
  Fly   260 VLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHL 324

Human   306 LLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQM 370
            ..:..|...:.....:|..:|:....|:..|:.::|.:||:::..||.:.:..:.|..|...:..
  Fly   325 FFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHR 389

Human   371 ----QVSLTSK----KHSR-----KSSSYSSSSTTVKT 395
                :..||:|    :|:|     ..|..:||..|.:|
  Fly   390 FDSPKSRLTNKNSSNRHTRGGYTVAHSLPNSSPPTTQT 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F2RL1NP_005233.4 7tmA_PAR2 76..355 CDD:320492 69/306 (23%)
TM helix 1 76..103 CDD:320492 8/35 (23%)
TM helix 2 110..135 CDD:320492 7/24 (29%)
TM helix 3 148..178 CDD:320492 8/31 (26%)
TM helix 4 189..211 CDD:320492 6/21 (29%)
TM helix 5 239..268 CDD:320492 9/30 (30%)
TM helix 6 280..310 CDD:320492 5/29 (17%)
TM helix 7 323..348 CDD:320492 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..397 10/32 (31%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 66/291 (23%)
7tm_1 100..363 CDD:278431 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.