DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EZH2 and SET2

DIOPT Version :9

Sequence 1:XP_011514185.1 Gene:EZH2 / 2146 HGNCID:3527 Length:759 Species:Homo sapiens
Sequence 2:NP_012367.2 Gene:SET2 / 853271 SGDID:S000003704 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:74/220 - (33%)
Similarity:99/220 - (45%) Gaps:58/220 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   547 CPCVIAQNFCEKF-------CQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAA 604
            |.|.      |:|       |...|:|.||                  |.:.||..|||.:||  
Yeast    68 CDCY------EEFSDGVNHACDEDSDCINR------------------LTLIECVNDLCSSCG-- 106

Human   605 DHWDSKNVSCKNCSIQRGSKKHLLLAPSDV-----AGWGIFIKDPVQKNEFISEYCGEIISQDEA 664
                      .:|..||..||.  .||..:     .|:|:..:..::.|:||.||.||:|.:.|.
Yeast   107 ----------NDCQNQRFQKKQ--YAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEF 159

Human   665 DRRGKVYD-KYMCSFLFNL--NNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAK 726
            ..|...|| ::...|.|.:  |.:| :|||.||:..||.|||.:||.|....:|....|:||||:
Yeast   160 RDRLIDYDQRHFKHFYFMMLQNGEF-IDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQ 223

Human   727 RAIQTGEELFFDY---RYSQADALK 748
            |.|..|||:.|||   ||. |.|.|
Yeast   224 RKILKGEEITFDYNVDRYG-AQAQK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EZH2XP_011514185.1 EZH2_WD-Binding 47..75 CDD:314486
SET 625..746 CDD:214614 51/131 (39%)
SET2NP_012367.2 AWS 64..119 CDD:197795 22/88 (25%)
SET_SETD2 119..260 CDD:380949 52/131 (40%)
SET 215..695 CDD:225491 18/34 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2678
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1072
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.