DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EZH1 and SET2

DIOPT Version :9

Sequence 1:NP_001308008.1 Gene:EZH1 / 2145 HGNCID:3526 Length:753 Species:Homo sapiens
Sequence 2:NP_012367.2 Gene:SET2 / 853271 SGDID:S000003704 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:82/295 - (27%)
Similarity:130/295 - (44%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   491 ELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDS-------TCPCIMTQN 548
            |::|.:.:..:..||:.   ::..|.:: :.|:..|...|.:.::...:       .|.|.    
Yeast    15 EILNNNAEGHKPQRLFD---QEPDLTEE-ALTKFENLDDCIYANKRIGTFKNNDFMECDCY---- 71

Human   549 FCEKF-------CQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV 606
              |:|       |..:.||.||                  |.:.||..|||.:||          
Yeast    72 --EEFSDGVNHACDEDSDCINR------------------LTLIECVNDLCSSCG---------- 106

Human   607 SCKNCSIQRGLKKHLLLAPSDV-----AGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD 666
              .:|..||..||.  .||..:     .|:|...::.::.|:||.||.||:|.:.|...|...||
Yeast   107 --NDCQNQRFQKKQ--YAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYD 167

Human   667 -KYMSSFLFNL--NNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEE 728
             ::...|.|.:  |.:| :|||.||:..||.|||.:||.|....:|....|:||||:|.|..|||
Yeast   168 QRHFKHFYFMMLQNGEF-IDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEE 231

Human   729 LFFDY---RY---------SQADALKYVGIERETD 751
            :.|||   ||         .:.:.:.::|.:.:||
Yeast   232 ITFDYNVDRYGAQAQKCYCEEPNCIGFLGGKTQTD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EZH1NP_001308008.1 EZH2_WD-Binding 45..73 CDD:288468
SANT 439..480 CDD:238096
SANT 439..480 CDD:197842
SET <469..733 CDD:225491 75/263 (29%)
SET 619..740 CDD:214614 50/140 (36%)
SET2NP_012367.2 AWS 64..119 CDD:197795 22/92 (24%)
SET_SETD2 119..260 CDD:380949 49/141 (35%)
SET 215..695 CDD:225491 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1072
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.