DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tfeb and Usf

DIOPT Version :9

Sequence 1:NP_035679.3 Gene:Tfeb / 21425 MGIID:103270 Length:534 Species:Mus musculus
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:394 Identity:71/394 - (18%)
Similarity:120/394 - (30%) Gaps:161/394 - (40%)


- Green bases have known domain annotations that are detailed below.


Mouse   161 KFAAHVSPAQGSPKPA--------PAASPGVR--AGH---------------------VLSTSAG 194
            :|.:..|....|..|:        |.|.||:.  ..|                     :|::..|
  Fly    12 EFGSSTSNTNTSTSPSSVNISNANPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLILTSDTG 76

Mouse   195 NSAPNSPMAMLHISSNPEKEFDD-----VIDNIMRLDSVLGYINP-EMQMPNTLPLSSSHLNVY- 252
            |...||..|.:.::...::..||     .|......|..:..:.| .:|:||.|.|.:. ..:| 
  Fly    77 NPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDLDIHSLLPSNLQLPNNLQLPTG-CEIYL 140

Mouse   253 -------SGDPQVTAS-------------MVGVTSSS---------------CPADLTQKRELTD 282
                   .|:|...|:             :..||:||               .|.::......|.
  Fly   141 VKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPPIPGNINTTTSTTS 205

Mouse   283 ----------------------AESRALAKER-----------QKKDN-----HNLIERRRRFNI 309
                                  |::|:..:..           :|:|:     ||.:|||||..|
  Fly   206 TTTTTSVLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYKKRDDKRRATHNEVERRRRDKI 270

Mouse   310 NDRIKELGMLIPK----------------------------------------ANDLDVRWNKGT 334
            |..|.:|..::|.                                        .||     :|..
  Fly   271 NSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGNASSSSGRAPPND-----SKSQ 330

Mouse   335 ILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQEL----EMQARVHGLPTTSPSGVN 395
            ||..:.:||:.||.::...|:....:..|..:|:.|...:..|    ::|.|.|.....|...|.
  Fly   331 ILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQALREELDRLKRQQQLQERFHTAGGRSTFNVT 395

Mouse   396 MAEL 399
            :..|
  Fly   396 LNSL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfebNP_035679.3 MITF_TFEB_C_3_N 63..219 CDD:292573 17/93 (18%)
HLH 291..351 CDD:238036 23/115 (20%)
DUF3371 379..531 CDD:288684 6/21 (29%)
UsfNP_572167.3 HLH 255..343 CDD:278439 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.