DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcf21 and Fer1

DIOPT Version :9

Sequence 1:NP_035675.1 Gene:Tcf21 / 21412 MGIID:1202715 Length:179 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:120 Identity:44/120 - (36%)
Similarity:67/120 - (55%) Gaps:13/120 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    31 FGT--SNESTEE------GSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANAR 87
            ||.  |:||.:|      |.|.:..:.:|......:|...|.:....|.::|     ||.|||.|
  Fly    35 FGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQ-----QRQAANLR 94

Mouse    88 ERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYEN 142
            ||.||:.:::||..|:|.:|.:|.:.:|||:|||:||.|||..|.:::..||..|
  Fly    95 ERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcf21NP_035675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..88 18/64 (28%)
HLH 80..132 CDD:278439 27/51 (53%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.