DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcf15 and Fer3

DIOPT Version :9

Sequence 1:XP_006499163.1 Gene:Tcf15 / 21407 MGIID:104664 Length:262 Species:Mus musculus
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:131 Identity:43/131 - (32%)
Similarity:57/131 - (43%) Gaps:37/131 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   117 GPGPGSGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRL 181
            |...||...:......|..:.||:|||.|||.|..::|.||..||..:||...:::||:||||||
  Fly    66 GRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRL 130

Mouse   182 ASSYIAHLANVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPRSICTFCLSNQRKGGSRRDLGG 246
            |.:||..:|.:|       .|.|                            ||..|  ||.|:.|
  Fly   131 AITYIGFMAELL-------SGTP----------------------------SNSHK--SRSDVYG 158

Mouse   247 S 247
            |
  Fly   159 S 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcf15XP_006499163.1 bHLH_TS_TCF15_paraxis 131..196 CDD:381476 30/64 (47%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.