DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcf15 and dimm

DIOPT Version :9

Sequence 1:XP_006499163.1 Gene:Tcf15 / 21407 MGIID:104664 Length:262 Species:Mus musculus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:105/284 - (36%) Gaps:83/284 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 RRKQAMLKGTYQRSPRNPDLRSWTAQTQSVRRRPAGPWERAGAH------------GGGGGSGTR 58
            ||...:...||       ||....:.:||......|.....|..            ||.|.||..
  Fly    54 RRTSQLSNNTY-------DLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRG 111

Mouse    59 RVE--ARGRAPMAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARRGPGPG 121
            ||:  :.|..|...|                     .|.:.|::|:.:.      .|:||..|..
  Fly   112 RVQQASSGACPSTIA---------------------PNSTSSNSSNANG------NASRRRKGAL 149

Mouse   122 SGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYI 186
            :.:..:         .:|..:|.|||.|..|:|.||.:||.:||...::|:|||||||.||.:||
  Fly   150 NAKERN---------MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYI 205

Mouse   187 AHLANVLLL---GDAA----DDGQPCFRAAGG-------GKSAVPAADGRQPRS-ICTFCLSNQR 236
            .:|.:::|.   .:||    :.|     |.||       .:|..|.|.|....| ..|.|..:..
  Fly   206 INLTHIILSKRNEEAAALELNSG-----AVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTL 265

Mouse   237 KGGSRRDLG------GSCLKVRGV 254
            ..|...|..      ||.|....|
  Fly   266 ASGGAFDCAILAATDGSLLNAATV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcf15XP_006499163.1 bHLH_TS_TCF15_paraxis 131..196 CDD:381476 28/67 (42%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.