DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcf15 and HLH4C

DIOPT Version :9

Sequence 1:XP_006499163.1 Gene:Tcf15 / 21407 MGIID:104664 Length:262 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:175 Identity:51/175 - (29%)
Similarity:71/175 - (40%) Gaps:53/175 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    87 LLSEDEENRSESDASDQSFGCCEGLEAARR-----GPGPGSGRRASNGAGPV------------- 133
            |::||....:..|. |:.|......|.|.:     .|.|...||.:    |:             
  Fly    37 LVNEDYAASTTLDI-DKRFQARMACETAAQPAPPPPPTPAPRRRTT----PIAHLDPSELVGLSR 96

Mouse   134 --------VVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLA 190
                    ..::.|.|...|||.|.::.|.:|..||.|:||.|.|:||||||.|:||..|||:|.
  Fly    97 EERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLN 161

Mouse   191 NVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPRSICTFCLSNQ 235
            :||   :.. |      :||..             |..|.||.|:
  Fly   162 HVL---ETPXD------SAGAS-------------SFATSCLFNE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcf15XP_006499163.1 bHLH_TS_TCF15_paraxis 131..196 CDD:381476 31/85 (36%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 30/59 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.