DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcf15 and Fer1

DIOPT Version :9

Sequence 1:XP_006499163.1 Gene:Tcf15 / 21407 MGIID:104664 Length:262 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:192 Identity:62/192 - (32%)
Similarity:85/192 - (44%) Gaps:44/192 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    92 EENRSESDASDQSFGCCEGLEA------------ARRGPGPGSGRRASNGAGPVVVVRQRQAANA 144
            :|:.||||..|.::.  .|..:            :||...|...:.||.      :.:||||||.
  Fly    37 DEHSSESDDEDDAYS--SGFNSDQENTEKTFCPFSRRSHKPRRLKCASQ------MAQQRQAANL 93

Mouse   145 RERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAA 209
            |||.|.||:|.||..|||.|||.|.:::|||::||:||.|||..|:.  ::....:..:|     
  Fly    94 RERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSE--MVKKDKNGNEP----- 151

Mouse   210 GGGKSAVPAADGRQPRSICTFCLSNQRKGGSRRDLG---------GSCLKVRGVAP--LRGP 260
              |.|.........|:.|    :...|.||....|.         ||.|..|...|  .|||
  Fly   152 --GLSLQRNYQKEPPKKI----ILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPRGP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcf15XP_006499163.1 bHLH_TS_TCF15_paraxis 131..196 CDD:381476 33/64 (52%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.