DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Megf11 and NimA

DIOPT Version :9

Sequence 1:XP_006511049.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:188 Identity:68/188 - (36%)
Similarity:90/188 - (47%) Gaps:15/188 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    25 NVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQ--- 86
            |:|...|.|...||.....|......:.|.:|..  :|.    ::||..|..:|.....:::   
  Fly    52 NICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--RCA----TFKTEMREVMRVQKLNKTRTVR 110

Mouse    87 -CCPGYYEN-GD---FCIPLCTEECMHGRCVSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQ 146
             ||.||..| .|   .|.|:|...|..|.||.||.|.||.|:.|..|:..||.:.||..|.|.||
  Fly   111 FCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQ 175

Mouse   147 CQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECL 204
            |||||.|:..:|.|.|..|:.|..||..|..||:|..|:..|.|.. ..|:|:||.|:
  Fly   176 CQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTGACI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Megf11XP_006511049.1 EMI 25..92 CDD:400092 17/70 (24%)
EGF_CA 188..233 CDD:419698 7/17 (41%)
EGF_CA 274..319 CDD:419698
NimANP_001285918.1 EMI 52..116 CDD:284877 16/69 (23%)
EGF_2 170..200 CDD:285248 15/29 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.