DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALCAM and orion

DIOPT Version :10

Sequence 1:NP_001618.2 Gene:ALCAM / 214 HGNCID:400 Length:583 Species:Homo sapiens
Sequence 2:NP_572427.1 Gene:orion / 31712 FlyBaseID:FBgn0027280 Length:664 Species:Drosophila melanogaster


Alignment Length:214 Identity:44/214 - (20%)
Similarity:72/214 - (33%) Gaps:69/214 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   311 YKCSLIDKKSMIASTAIT------------VHYL------------DLSLN-PSGEVTRQIGDAL 350
            ||    ||..|  ||.||            ||:|            |.|.| .|..:.:|:..|.
  Fly   139 YK----DKLEM--STLITFAEWTVSPNAHSVHHLMDRLHITLLGNEDRSSNTTSTNLLQQLATAY 197

Human   351 PVS----CTISASRNATVVWMKDNIRLRSSPSFSSLHYQ-------DAGNYVCETALQEVEGLKK 404
            .||    |....|....:..:..:|.|....:::.:.:.       ..|||..|..:...| .:|
  Fly   198 EVSTDQICNTMQSAQQFIYSLYADIALTELKAYTMMEFSWMMLRVYGKGNYTQEAEIMRSE-YEK 261

Human   405 RESLTLIVEGKPQIKMTK---KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYIN 466
            |...||.:.....::..:   :.||:.       ||.|                :...|.:..:.
  Fly   262 RTERTLKILKDVMLRADRIVYRCDPTK-------HVRG----------------VTYDEVTRLLQ 303

Human   467 GRYYSKIIISPEENVTLTC 485
            |...:::.::.||....||
  Fly   304 GYIENEVDLNKEETCRETC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALCAMNP_001618.2 IGv 38..113 CDD:214650
Ig strand B 39..43 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 96..100 CDD:409353
Ig strand F 110..115 CDD:409353
C2-set_2 137..231 CDD:400489
Ig strand B 143..157 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 203..207 CDD:409353
Ig strand F 217..222 CDD:409353
IG_like 255..329 CDD:214653 9/29 (31%)
Ig strand B 266..270 CDD:409353
Ig strand C 280..284 CDD:409353
Ig strand E 296..300 CDD:409353
IG_like 339..393 CDD:214653 12/64 (19%)
Ig strand C 363..367 CDD:409353 0/3 (0%)
Ig strand F 389..393 CDD:409353 2/3 (67%)
Ig_3 415..489 CDD:464046 11/74 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..583
orionNP_572427.1 DUF4803 202..456 CDD:465000 24/145 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.