DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALCAM and igcm-1

DIOPT Version :10

Sequence 1:NP_001618.2 Gene:ALCAM / 214 HGNCID:400 Length:583 Species:Homo sapiens
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:631 Identity:132/631 - (20%)
Similarity:237/631 - (37%) Gaps:138/631 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    11 LLFCLLI-------SATVF--RPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPV 66
            |.|..|:       |:.||  .|....|.:... .:.|:|||   |.:...|.:.|||..     
 Worm     9 LFFLFLVQLTNSADSSDVFLKEPSSEPYFLQEG-NEGIVIPC---VVKPEYFDRQKYEIN----- 64

Human    67 FIAFRSSTKKSVQYDD--VPEYKDRLNLSE-----NYTLSISNA-RISDEKRFVCMLV-TEDN-- 120
            :..:.:...:.:..:|  :.:...|..|..     ||:|.|:.. :.|.|..:.|.:: |:|:  
 Worm    65 WARYNNGQLRMITKNDKLLAKKHSRFILENDSATGNYSLRITEVEKNSVEGTYHCNVIGTDDSDV 129

Human   121 VFEAPTIVKVFKQPSKP-------EIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLH 178
            .:.|...|.|...|..|       |.|.:..|:..:       |:|....|....||......: 
 Worm   130 QYSALATVVVLVPPGDPIISTTPSESVIEGDFMTAK-------CVSVGGSPQPTFTWTLPNDTI- 186

Human   179 PLEGAVVIIFKKEM-DPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVFDI 242
                |...||..:. |..|:     |.|.::.|.:|......|.||.....|.:|...:.:..::
 Worm   187 ----ASSAIFTTQFRDGATE-----SLLHFRVTSSDDGKSVQCDVTNRAMLGGETKQVKSSQLNV 242

Human   243 YY-------PTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTY-- 298
            .|       |||.:|      ..:::||:.:.|.|....|||...:      :.:.|.|...|  
 Worm   243 LYKPVVFVTPTENLT------HLSVEEGELVNLTCNSASNPPAHSY------EWKHIASGERYQG 295

Human   299 TLTDVR--RNATGDYKCSLIDKKSMIASTAI---TVHYLDLSLNPSGEVTRQIGDALPVSCTISA 358
            .:..:|  .:.:||::|.  ....:...||:   .|.::. .:|....::....:.:.:.|.:||
 Worm   296 KIWPIRVDSSMSGDFECR--STNELGEGTAVLKMVVQHIP-RINVPESISPNEMEDIDILCEVSA 357

Human   359 SRNA-TVVWM-----KDNIRLRSSPSFSSLHYQDAGNYVC-ETALQEVEG----LKKRESLTLIV 412
            .... .:.|:     |.|   .|..:.:|:....:|||.| .|....|.|    .::..:.|.||
 Worm   358 VPEVIDIKWVGPNGFKQN---GSRLTITSISKAQSGNYTCMATNFLTVYGHSGSQQRMGTGTTIV 419

Human   413 E-----GKPQIKMTKKTDPSGLSKTIICHVE--GFPKPAIQWTITGSGSVI---NQTEESPYING 467
            :     |:.||...::....|.:..::|..|  |.|..:..|....||.:.   ..||:|..:..
 Worm   420 DVKRKPGQAQIVSARQNVDVGETIKLMCQAEDAGNPSASYTWASPSSGGIFGLEGHTEKSFEVRN 484

Human   468 RYYSKIIISPEENVTLTCTAENQL-ERTVNSLNVSAISIPEHDEADEISDENREKV---NDQAKL 528
            ...|       :|...:|.|.|.| |..:.::.::.|     ::|...|....|::   .:|.|:
 Worm   485 AQLS-------DNGVYSCKAYNDLGEGKIGTVMITVI-----EKARISSPLATERIFTSGEQGKI 537

Human   529 IVGIVVGLLLAALVAGVVYWL----------YMKKSKTASKHVNKD 564
            :.....|     ..:.|:.||          |...:.:.||.:.:|
 Worm   538 LECEAQG-----YPSPVIKWLKDGRPVKQSIYASSATSESKCLPED 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALCAMNP_001618.2 IGv 38..113 CDD:214650 18/82 (22%)
Ig strand B 39..43 CDD:409353 2/3 (67%)
Ig strand C 55..59 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 2/3 (67%)
Ig strand F 110..115 CDD:409353 1/4 (25%)
C2-set_2 137..231 CDD:400489 22/101 (22%)
Ig strand B 143..157 CDD:409353 1/13 (8%)
Ig strand C 167..171 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
IG_like 255..329 CDD:214653 16/80 (20%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 280..284 CDD:409353 0/3 (0%)
Ig strand E 296..300 CDD:409353 1/5 (20%)
IG_like 339..393 CDD:214653 12/60 (20%)
Ig strand C 363..367 CDD:409353 0/3 (0%)
Ig strand F 389..393 CDD:409353 3/4 (75%)
Ig_3 415..489 CDD:464046 17/78 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..583 1/3 (33%)
igcm-1NP_508166.1 Ig 140..235 CDD:472250 24/111 (22%)
Ig strand B 162..166 CDD:409418 0/10 (0%)
Ig strand C 176..181 CDD:409418 2/4 (50%)
Ig strand E 203..207 CDD:409418 2/3 (67%)
Ig strand F 217..222 CDD:409418 1/4 (25%)
Ig strand G 231..234 CDD:409418 1/2 (50%)
Ig_3 245..316 CDD:464046 18/84 (21%)
Ig_3 333..398 CDD:464046 13/68 (19%)
IG_like 437..513 CDD:214653 18/82 (22%)
Ig strand B 443..447 CDD:409353 0/3 (0%)
Ig strand C 458..461 CDD:409353 0/2 (0%)
Ig strand E 478..482 CDD:409353 1/3 (33%)
Ig strand F 492..497 CDD:409353 1/4 (25%)
Ig 538..617 CDD:409353 8/46 (17%)
Ig strand C 549..553 CDD:409353 1/3 (33%)
Ig strand E 586..590 CDD:409353
Ig strand F 601..606 CDD:409353
Ig 642..727 CDD:472250
Ig strand B 650..654 CDD:409353
Ig strand C 663..667 CDD:409353
Ig strand E 688..699 CDD:409353
Ig strand F 709..714 CDD:409353
FN3 733..843 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.