DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp6d2

DIOPT Version :9

Sequence 1:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_611698.1 Gene:Cyp6d2 / 37594 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster


Alignment Length:534 Identity:140/534 - (26%)
Similarity:256/534 - (47%) Gaps:42/534 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 TVTLLVALLALLKWYSMSAFSRLEKLGI-RHPKPSPF--VGNLMFFRQGFWESQLELRERY-GPL 77
            |:.|.:.:..||..|....::..::||: ..|...||  :..:|...:....:..::..|: |.:
  Fly     3 TILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIYARHEGKI 67

Mouse    78 CGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPK-MVADSVLLLRDRRWEEVRGALMS 141
            .|.|:..:..::|.:..:.:|::..:|::|.:|.....|.| .::.::..||...|..:|..|..
  Fly    68 VGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQKLTP 132

Mouse   142 SFSPEKLDEMTPLISQACELLVAHLKRYAASRDAFNIQRCYCCYTIDVVASVAFGTQVDSQNSPE 206
            |||..|:..|...|....:.||.||:......|...|:.....|.:|::.||.||.::||..:|:
  Fly   133 SFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEIDSFRNPK 197

Mouse   207 DPFVQHCRRASTFCIPRPLLVLILSFPSIMV--PLARILPNKNRDELNGFFNTLIRNVIALRDQQ 269
            :.|    |..|:.......|:|.:...|:.:  |:|:::   ||........|.:|:::. |..:
  Fly   198 NEF----REISSSTSRDESLLLKIHNMSMFICPPIAKLM---NRLGYESRILTSLRDMMK-RTIE 254

Mouse   270 AAEER---RRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCHPTSTSKPFTVDEI 331
            ..||.   |:|.||:::..::: ..:| |..|.|.:..::.|             ..|..::::|
  Fly   255 FREEHNVVRKDMLQLLIRLRNT-GKIG-EDDDQVWDMETAQE-------------QLKSMSIEKI 304

Mouse   332 VGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKH---PAPE--YHSLQEGLP 391
            ..|||||.:||.|......:|..|.|:.:|:..:...:|||..:.||   |...  |.::|: |.
  Fly   305 AAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQD-LK 368

Mouse   392 YLDMVISETLRMYPPAFRFTREAAQDCEVLGQR--IPAGTVLEIAVGALHHDPEHWPNPETFDPE 454
            :||:.|.||:|.||......||..:|..|.|..  |..||.:.|::..:..||.::|||..:||.
  Fly   369 FLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPH 433

Mouse   455 RFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASPETQVPLQLESKSA 519
            ||.:. .:......|:|||.|||.|:.:|:|.:..|:.:.::|..|....||..:|..:.::...
  Fly   434 RFDSN-NMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPV 497

Mouse   520 LGPKNGVYIKIVSR 533
            |..|..:.:::..|
  Fly   498 LVTKEPLKLRLTKR 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..528 CDD:365848 132/496 (27%)
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 127/465 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.