DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:528 Identity:146/528 - (27%)
Similarity:246/528 - (46%) Gaps:46/528 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 IVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNLMFFR-----QGFWESQLELRERY 74
            :..|.:||..| ||||  ..|....:.|.|...:|...:|:|...:     ...|..........
  Fly     8 LAIVVVLVGYL-LLKW--RRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWMDYYNKFRGT 69

Mouse    75 GPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNR-MASGLEPKMVADSVLLLRDRRWEEVRGA 138
            ||..|:|..:|..:::.:..:.|.:|::.|:.|::| .....|...::..:.||..::|:.:|..
  Fly    70 GPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLLDGQKWKSMRSK 134

Mouse   139 LMSSFSPEKLDEMTPLISQACELLVAHLKRYAASRDAFNIQRCYCCYTIDVVASVAFGTQVDSQN 203
            |..:|:..|:..|.|.:.:.....:....:.........::.....:|.||:.:.|||.:..|..
  Fly   135 LSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLK 199

Mouse   204 SPEDPFVQHCRRASTFCIPRPL-LVLILSFPSIMVPLARILPNK-NRDELNGFFNTLIRNVIALR 266
            .||..|....|||.......|: :..|.||.:    |||.|..| ..:|...||..::|..:|.|
  Fly   200 DPEAEFRVMGRRAIFEQRHGPIGIAFINSFQN----LARRLHMKITLEEAEHFFLRIVRETVAFR 260

Mouse   267 DQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCHPTSTSKPFTVDEI 331
            ::.  ..||.||:..::|.::|              .|:.||           :..|...|::|:
  Fly   261 EKN--NIRRNDFMDQLIDLKNS--------------PLTKSE-----------SGESVNLTIEEM 298

Mouse   332 VGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAPEYHSLQEGLPYLDMV 396
            ..|||:|..||.|..:.|:.|..|.||.|.|.|:|:.||....:||:.....:...:.:.|||.|
  Fly   299 AAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQV 363

Mouse   397 ISETLRMYPPAFRFTREAAQDCEVLGQR---IPAGTVLEIAVGALHHDPEHWPNPETFDPERFTA 458
            ||||||:|.......||..:|.||.|..   |..|..:.|..||:|.|.:.:.||.||:|:.|:.
  Fly   364 ISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSP 428

Mouse   459 EARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASPETQVPLQLESKSAL-GP 522
            |...:|....:||||.|||:|:|:|.|.:..:..:..::::|:|....:|.:|:....|:.| ..
  Fly   429 ERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISS 493

Mouse   523 KNGVYIKI 530
            :.|:::|:
  Fly   494 ETGIFLKV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..528 CDD:365848 134/492 (27%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 134/494 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.