DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:546 Identity:146/546 - (26%)
Similarity:242/546 - (44%) Gaps:82/546 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 IVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPF-----VGNLMFFRQGFWE--SQLELRE 72
            ::.:.||:..:..|.::....:......||.|..||.:     :|.|:|.|..|.:  .||....
  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADP 65

Mouse    73 RYG--PLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRM--ASGLEPKMVADSVLLLRDRRWE 133
            |.|  .:.|:::.:...:::.:|::|:|||::||:||.||.  |...:| |.|.::.|.:...|:
  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDP-MGALTLPLAKYHHWK 129

Mouse   134 EVRGALMSSFSPEKLDEMTPLISQACELLVAHLKRYAASRDAFNIQRC-----YC-CYTIDVVAS 192
            |.|..:...|:..::.::  :.||..: :.:.|::|...:....::|.     .| .||.||..:
  Fly   130 ESRQCMSQLFTSGRMRDV--MYSQMLD-VASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGN 191

Mouse   193 VAFGTQVDSQNSPEDPFVQHCRRASTFCIPRPLLVLILSFPSIMVPLARILPNKNRDELNGFFNT 257
            :.:...|..           .||..:..|.:            ...|....|.|..|.::.||  
  Fly   192 LFYSLNVGG-----------LRRGRSELITK------------TKELFNTNPRKVLDFMSVFF-- 231

Mouse   258 LIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPE------SLSSSECTKEPPQR 316
            |.:....|:.:...|:..| :::.::|..|.    ..:| |::.:      |.||:..::.|   
  Fly   232 LPKWTGVLKPKVFTEDYAR-YMRHLVDDHHE----PTKG-DLINQLQHFQLSRSSNHYSQHP--- 287

Mouse   317 CHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAP 381
                        |.:..||.:.|:||.|..:..:.|..|.||..||.||||..|:..........
  Fly   288 ------------DFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATL 340

Mouse   382 EYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEV-------LGQRIPAGTVLEIAVGALH 439
            .|.:|.. ||||.||..|.||:||.|....||.......       :...:|.|....|::..||
  Fly   341 SYDTLMT-LPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLH 404

Mouse   440 HDPEHWPNPETFDPERFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEA 504
            .|...||.|..||||||..|......|.||:||||||..|:|.|||:|.:||.|:.:|.::..|.
  Fly   405 RDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET 469

Mouse   505 SPETQVPLQLESKS-ALGPKNGVYIK 529
            ...|...::...|| .|..:|.:|::
  Fly   470 CERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..528 CDD:365848 139/511 (27%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 137/502 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.