DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp28d2

DIOPT Version :9

Sequence 1:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster


Alignment Length:548 Identity:134/548 - (24%)
Similarity:228/548 - (41%) Gaps:94/548 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 IVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNL--MFFRQGFWESQL-ELRERY-- 74
            ::.:||||.:...|.|    .|:...|.||:.....||||:.  :|.|:......: ::.|:|  
  Fly     9 VLVLTLLVLVYVFLTW----NFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDIDDIYEKYKD 69

Mouse    75 -GPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPK----MVADSVLLLRDRRWEE 134
             ..:.|.:..|...:::..|:.|.::...:|.:|.|........|    ::.::..:|....|:|
  Fly    70 TDNMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNEWRNFVNKKTDMILGNNPFVLTGDEWKE 134

Mouse   135 VRGALMSSFSPEKLDEMTPLISQACELLVAHLKR--YAASRDAFNIQRCYCCYTIDVVASVAFGT 197
            .|..:|.:.||.::..:.|:....|:..|.:::|  ..|:.:..:......|||.:||:....|.
  Fly   135 RRSEIMPALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLGV 199

Mouse   198 QVDSQNSPEDPFVQHCRRASTFCIPRPLLVLILSFPSIMVPLARILPNKNR---------DELNG 253
            ...|......|.::..:|           |...||..|...:...|..|.|         .|...
  Fly   200 SAQSFTDTPTPLLKMIKR-----------VFNTSFEFIFYSVVTNLWQKVRKFYSVPFFNKETEV 253

Mouse   254 FFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCH 318
            ||..:||..|.|| .:..|::|.|||..:|..|.                               
  Fly   254 FFLDIIRRCITLR-LEKPEQQRDDFLNYMLQLQE------------------------------- 286

Mouse   319 PTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEV---DLFMGKHPA 380
                .|....|.|:.....|::.|.|.....|:.|..:|..:|:.|:::.||:   ||       
  Fly   287 ----KKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEIGSADL------- 340

Mouse   381 PEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQ-----RIPAGTVLEIAVGALHH 440
             .:..:.| ||:||..|.||||::.|.....:...:..|...:     .:..|.|:.|.|.||||
  Fly   341 -TFDQMSE-LPHLDACIYETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHH 403

Mouse   441 DPEHWPNPETFDPERFTAE----ARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFR 501
            ||:::.:|.||.||||...    .:..|....||.||.|||.|.|:|..|..:|..::::|..|.
  Fly   404 DPQYYEDPLTFKPERFLESNGGGMKSYRDRGVYLAFGDGPRHCPGMRFALTQLKAALVEILRNFE 468

Mouse   502 FEASPETQVPLQLESKSALGP-KNGVYI 528
            .:.:|:|:...|::....:.. |.|:|:
  Fly   469 IKVNPKTRSDNQIDDTFFMATLKGGIYL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..528 CDD:365848 123/514 (24%)
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 119/492 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.