DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp28c1

DIOPT Version :9

Sequence 1:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster


Alignment Length:550 Identity:129/550 - (23%)
Similarity:237/550 - (43%) Gaps:96/550 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 TLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVG---NLMFFRQGFWESQLELRERY------ 74
            |||.|:.|.|    :|.|....:.|:..|:..|..|   |:::.||.|   .:::|:.|      
  Fly    11 TLLGAIYAFL----VSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHF---TMDMRDIYMHYRNT 68

Mouse    75 GPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGL----EPKMVADSVLLLRDRRWEEV 135
            ....|.||.|...:::.||.::.::.|..||:|.|..||.:    :.::||.:..:|....|...
  Fly    69 HSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPFVLEGEEWRHQ 133

Mouse   136 RGALMSSFSPEKLDEMTPLISQACELLVAHLK-RYAASRD--------AFNIQRCYCCYTIDVVA 191
            |....:..:..::.....::.:.|..|...:. :.|..:|        .|..:..:.|       
  Fly   134 RAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKDLDCIDLGLRFTGESLFDC------- 191

Mouse   192 SVAFGTQVDSQNSPEDPFVQHCRRAST----FCIPRPLLVLILSFPSIMVPLARILPNKNRDELN 252
              ..|.|..:......|.|:.....|.    ..|...:..|..:.|..:.|  ::.|..:    :
  Fly   192 --VLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWLRP--KVFPRSH----D 248

Mouse   253 GFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRC 317
            .|:..:|..  |||.:::..:.|.||:..:|:.|..:        |:..|.::|           
  Fly   249 RFYGQMISE--ALRLRRSKHQERNDFINHLLEMQREL--------DLSEEDMAS----------- 292

Mouse   318 HPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAPE 382
                            .|..|:..|.:..:|:::....||..:||||.||.:|:.|.......|:
  Fly   293 ----------------HAMTFMFDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGYLPD 341

Mouse   383 YHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQ------RIPAGTVLEIAVGALHHD 441
            ..:|.: ||||....:|:||:||.....::...::.|:.|.      ::..|..:.:.:.|||:|
  Fly   342 LDALID-LPYLSACFNESLRIYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHND 405

Mouse   442 PEHWPNPETFDPERFTAEARLQ--RRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEA 504
            |:.:|.|:.|.|||| .:..|:  ::...:|.||.|||.|:|:||||.:.|..:..::.:|....
  Fly   406 PDLYPEPDVFRPERF-LDGGLKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVV 469

Mouse   505 SPETQVPLQLESKSALG-PKNGVYIKIVSR 533
            ||.|....:|:....:| .|.|::::.|.|
  Fly   470 SPRTLNGTELDPLIFVGVHKGGIWLQFVPR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..528 CDD:365848 118/515 (23%)
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 115/508 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.