DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbx6 and byn

DIOPT Version :10

Sequence 1:NP_035668.2 Gene:Tbx6 / 21389 MGIID:102539 Length:436 Species:Mus musculus
Sequence 2:NP_524031.2 Gene:byn / 39349 FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster


Alignment Length:83 Identity:23/83 - (27%)
Similarity:39/83 - (46%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   516 LLSPGSWNGD-KISRGSASKSSSRAGSRPNSRPITPAAAPTPDAAPEEHSAPSSKVPSRTPSRQS 579
            :||..|.:|. .:.||:....||.:....:..|  |:   :|..:|:.|. ||:..||  |||  
  Fly     3 MLSTASVSGSVDLPRGTMKVDSSASPEVVSDLP--PS---SPKGSPDRHD-PSTSSPS--PSR-- 57

Mouse   580 AKVEQGSDMEIKALQKTD 597
                 |.|.:.:.:.|::
  Fly    58 -----GGDNQSEVISKSE 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbx6NP_035668.2 T-box_TBX6 91..273 CDD:410322
PRK07764 <326..>424 CDD:236090
bynNP_524031.2 T-box_TBXT_TBX19-like 87..264 CDD:410318
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.