DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbx2 and Doc1

DIOPT Version :9

Sequence 1:NP_033350.2 Gene:Tbx2 / 21385 MGIID:98494 Length:711 Species:Mus musculus
Sequence 2:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster


Alignment Length:330 Identity:145/330 - (43%)
Similarity:196/330 - (59%) Gaps:48/330 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 LEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWM 173
            ||..:||.||||:||||:||||||||||..:|.:|||:::|.|.:|:::|...||||||..|:|:
  Fly    63 LENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCRYKFSGSQWV 127

Mouse   174 VAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVR 238
            .||.|:|:.|:|||:||||||||..|.::.:.|:|:|||||..|..|..:|.||||||||.||:|
  Fly   128 PAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASMHKYQPRLHIIR 192

Mouse   239 ANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLTLPT 303
            ::::.:||::..:.:|||||:|:||||||||:||:|||||||||||||::|..|. |||..:...
  Fly   193 SSELTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGFRESGQSRC-KRKLNSSGN 256

Mouse   304 LRLYEEHCKPERDGAESDASSCDPPPAR------EPPPSPSAAP-------------SP-LRLHR 348
            ..|     :.|.||  |..||||.|.|:      |...:.|.:|             || ||.|.
  Fly   257 STL-----ESEDDG--SSVSSCDSPQAKRQRQDFEQDSTGSVSPAYYGATHPVANPMSPYLRHHL 314

Mouse   349 ARAEEKPGAADSDPE----------------PERTGEERSA--APLGRSPSRDASPARLTEPERS 395
            :....  |||...|.                |..|.....|  :|:...|...::|.....|..|
  Fly   315 SYGPS--GAAGLPPSIAAAYFGGVPPQILPMPPATYAPTVAPVSPVASQPVGSSTPTTSPRPSTS 377

Mouse   396 RERRS 400
            .:|.|
  Fly   378 TKRNS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbx2NP_033350.2 TBOX 104..289 CDD:238106 107/179 (60%)
TBX 305..382 CDD:204975 28/114 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..449 32/126 (25%)
Repression domain 1 (RD1). /evidence=ECO:0000250 518..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..687
Doc1NP_648283.1 TBOX 58..245 CDD:238106 108/181 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2837
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.