DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbca and CG1890

DIOPT Version :9

Sequence 1:NP_033347.1 Gene:Tbca / 21371 MGIID:107549 Length:108 Species:Mus musculus
Sequence 2:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster


Alignment Length:107 Identity:45/107 - (42%)
Similarity:73/107 - (68%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIP 65
            |.|||:||:.||:||||||.:|:..|.||...::.::||::.:..:::.::||.|::||..||:|
  Fly     1 MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVIQECIMMVP 65

Mouse    66 DCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSVKLE 107
            |.:|||:..|..|::.|..|:||.|.:.||:|..:|...|.|
  Fly    66 DSKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcaNP_033347.1 TBCA 9..93 CDD:308555 33/83 (40%)
CG1890NP_651885.1 TBCA 9..94 CDD:281033 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850683
Domainoid 1 1.000 81 1.000 Domainoid score I8536
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3388
Inparanoid 1 1.050 101 1.000 Inparanoid score I4971
Isobase 1 0.950 - 0 Normalized mean entropy S871
OMA 1 1.010 - - QHG59154
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 1 1.000 - - oto93559
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2310
SonicParanoid 1 1.000 - - X4256
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.