DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tal1 and HLH4C

DIOPT Version :9

Sequence 1:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:161 Identity:49/161 - (30%)
Similarity:67/161 - (41%) Gaps:51/161 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    89 EARLRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQLSPPALAAPAGPGRALLYSLSQPLASL 153
            :||:   ..|....|.|.|.|.||                         |.|.     :.|:|.|
  Fly    55 QARM---ACETAAQPAPPPPPTPA-------------------------PRRR-----TTPIAHL 86

Mouse   154 GSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRK 218
                  :|......:...|.:||.:..:...:..            :|||.|.:..|.:||||||
  Fly    87 ------DPSELVGLSREERRRRRRATLKYRTAHA------------TRERIRVEAFNVSFAELRK 133

Mouse   219 LIPTHPPDKKLSKNEILRLAMKYINFLAKLL 249
            |:||.||||||||.|||:||:.||.:|..:|
  Fly   134 LLPTLPPDKKLSKIEILKLAICYIAYLNHVL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 31/59 (53%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.