DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tacr2 and TkR86C

DIOPT Version :9

Sequence 1:NP_033340.3 Gene:Tacr2 / 21337 MGIID:98477 Length:384 Species:Mus musculus
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:344 Identity:121/344 - (35%)
Similarity:194/344 - (56%) Gaps:26/344 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 FSMPGWQLALWATAYLALVLVAVTGNATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFN 90
            :.:|..|..:||..:..::.||:.||..|:||:..|..||||||||::||::|||.|::.|..||
  Fly    76 YELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFN 140

Mouse    91 FIYASHNIWYFGSTFCYFQNLFPVTAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVI 155
            ||:..::.|.|||.:|...|......:..|::::.||:.|||:|||||.:.|.|....:.::.:|
  Fly   141 FIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKRRTSRRKVRIILVLI 205

Mouse   156 WLVALALASPQCFYSTITV-----DQGATKCVVAWPNDNGGKML--LLYHLVVFVLIYFLPLVVM 213
            |.::..|::|...||:|..     .:..|.|.:.||:......:  ..|:|::.||.|.:|::||
  Fly   206 WALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVM 270

Mouse   214 FAAYSVIGLTLW-KRAVPRHQAHGAN----LRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILG 273
            ...||::|..|| .|::      |.|    :..:::|:|.|:..:.:|..||||||||||:||..
  Fly   271 LICYSLMGRVLWGSRSI------GENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYA 329

Mouse   274 TFQEDIYYRKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWGTPT---EEDR 335
            .....:...|::|.:||..:|||||:.|.||:||..:|.|||..|:....||..|...   :..:
  Fly   330 YHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFRMYFQRIICCCCVGLTRHRFDSPK 394

Mouse   336 LELTHTPSISRRVNRCHTK 354
            ..||:..|.:|     ||:
  Fly   395 SRLTNKNSSNR-----HTR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tacr2NP_033340.3 7tm_4 42..>168 CDD:304433 50/125 (40%)
7tm_1 50..307 CDD:278431 99/268 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..384
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 108/289 (37%)
7tm_1 100..363 CDD:278431 99/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837172
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55548
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314830at33208
OrthoFinder 1 1.000 - - FOG0000620
OrthoInspector 1 1.000 - - mtm8831
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3520
SonicParanoid 1 1.000 - - X257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.