DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tacc3 and Rok

DIOPT Version :9

Sequence 1:XP_011239017.1 Gene:Tacc3 / 21335 MGIID:1341163 Length:646 Species:Mus musculus
Sequence 2:NP_536796.2 Gene:Rok / 43916 FlyBaseID:FBgn0026181 Length:1390 Species:Drosophila melanogaster


Alignment Length:356 Identity:79/356 - (22%)
Similarity:146/356 - (41%) Gaps:89/356 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   308 IEPLLEPSHQGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQFGTSSFKESAWRKQSLYVKFDPLL 372
            :|.||| ..:|....::.::...|...|:: |..|.: |::..:...|:.|.|:.:..|....:.
  Fly   460 LEALLE-RERGRSEALEQQDAGLRQQIELI-TKREAE-LQRIASEYEKDLALRQHNYKVAMQKVE 521

Mouse   373 KDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPPLCVLEPRGLLPAEP 437
            ::..||....|.:..:.::.|.|    :.|.|..:|::                           
  Fly   522 QEIELRKKTEALLVETQRNLENE----QKTRARDLNIN--------------------------- 555

Mouse   438 IVDVLKYSQKDLDAVVNVMQQENLELKSKY--EDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRE 500
                        |.||: ::::.||::..|  |..||:.|:...:..:|   ..||.|  ||.|:
  Fly   556 ------------DKVVS-LEKQLLEMEQSYKTETENTQKLKKHNAELDF---TVKSQE--EKVRD 602

Mouse   501 LKEIAEDKIQKVLKERDQLNADLNSM---EKSFSDLFKRFEKRKE-----VIEGY-------QKN 550
            :.::. |.:||..:|..|.||:|.::   ||:.....|...|..|     :|...       ||.
  Fly   603 MVDMI-DTLQKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKA 666

Mouse   551 EESLKKYVGECIVKIEK------------EGQRYQALKIHAE-EKLRLANEEIAQVHSKAQAEVL 602
            :|..:..: |.|..:||            :|:..|.:|.|.| ||.||.:.|.|.:.     ||.
  Fly   667 QEDNRALL-EKISDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQ-----EVK 725

Mouse   603 ALQASLRKAQMQNHSLEMTLEQKTKEIDELT 633
            |||:.|.:.:......:...::|.:::..|:
  Fly   726 ALQSKLNEEKSARIKADQHSQEKERQLSMLS 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tacc3XP_011239017.1 PRK10263 <23..>274 CDD:236669
rne <160..310 CDD:236766 0/1 (0%)
TACC 444..640 CDD:368238 57/220 (26%)
RokNP_536796.2 STKc_ROCK 61..411 CDD:270747
S_TKc 87..349 CDD:214567
SbcC 484..1088 CDD:223496 73/331 (22%)
Rho_Binding 963..1027 CDD:286056
PH_ROCK 1134..1250 CDD:269948
C1 1254..1307 CDD:197519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.