DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EWSR1 and GAR1

DIOPT Version :9

Sequence 1:XP_011528297.1 Gene:EWSR1 / 2130 HGNCID:3508 Length:670 Species:Homo sapiens
Sequence 2:NP_011957.1 Gene:GAR1 / 856489 SGDID:S000001131 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:90/331 - (27%)
Similarity:106/331 - (32%) Gaps:153/331 - (46%)


- Green bases have known domain annotations that are detailed below.


Human   310 RGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVT 374
            ||| :||||||.|||.     |||.........:||         ||                 |
Yeast     4 RGG-NRGGRGGFRGGF-----RGGRTGSARSFQQGP---------PD-----------------T 36

Human   375 LDDLADFFKQC--GVVKMNKRTGQPMIH--IYLDKETGKPKGDA----------TVSYEDPPTAK 425
            :.::..|...|  .:|..:..|..|..:  |||:.:|...|.|.          |:...|...|.
Yeast    37 VLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQAT 101

Human   426 AAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGP-------GGPGG 483
            :..|        |.|..:: |.|..|:.           |.:|.|...||..|       |.|||
Yeast   102 SFKE--------GDKFYIA-ADKLLPIE-----------RFLPKPKVVGPPKPKNKKKRSGAPGG 146

Human   484 PMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPSIGDFCCDVIVCRGCGNQNF 548
            ..|...||||.||||     ||.||..|                                     
Yeast   147 RGGASMGRGGSRGGF-----RGGRGGSS------------------------------------- 169

Human   549 AWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGP-GGMFRGG-RGGDRG 611
                                                .||||||...|||. ||.|||| |||.||
Yeast   170 ------------------------------------FRGGRGGSSFRGGSRGGSFRGGSRGGSRG 198

Human   612 GFRGGR 617
            ||||||
Yeast   199 GFRGGR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EWSR1XP_011528297.1 RRM <351..>459 CDD:223796 23/121 (19%)
RRM_EWS 362..445 CDD:240977 18/96 (19%)
zf-RanBP 519..561 CDD:279035 0/41 (0%)
RanBP2-type Zn finger 523..557 CDD:275375 0/33 (0%)
GAR1NP_011957.1 Gar1 29..>124 CDD:398216 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.